PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2AL_0A21FB42C.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 332aa    MW: 36662.2 Da    PI: 8.4841
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2AL_0A21FB42C.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.26.8e-122570146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                           +g+W +eEd  l++ v+ +G+++W++I ++  + Rt+k+c++rw +
  Traes_2AL_0A21FB42C.1 25 KGPWMAEEDAVLLEHVRTHGPRDWSSIRSKGALQRTGKSCRLRWVN 70
                           79*************************998889***********87 PP

2Myb_DNA-binding41.43.3e-1381121345
                            SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            +++++E+   +++ +q+G++ W++Ia +++ gRt++++k++w 
  Traes_2AL_0A21FB42C.1  81 KFSADEERVVIELQAQFGNK-WARIATYLP-GRTDNDVKNFWS 121
                            79******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.3892072IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-182273IPR009057Homeodomain-like
SuperFamilySSF466895.47E-2623120IPR009057Homeodomain-like
SMARTSM007172.5E-92474IPR001005SANT/Myb domain
PfamPF002492.6E-102570IPR001005SANT/Myb domain
CDDcd001674.17E-92772No hitNo description
PROSITE profilePS5129419.9273128IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-1774126IPR009057Homeodomain-like
SMARTSM007171.5E-1178126IPR001005SANT/Myb domain
PfamPF002491.8E-1181121IPR001005SANT/Myb domain
CDDcd001673.27E-1081120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MARAPGGAAR RRGGRRDGGG EAVRKGPWMA EEDAVLLEHV RTHGPRDWSS IRSKGALQRT  60
GKSCRLRWVN KLRPNLKTGC KFSADEERVV IELQAQFGNK WARIATYLPG RTDNDVKNFW  120
STRQKRLARL LRAPLRARPS KTRSSNTKAP ASSLESAMER QGSCHDHVPS VGNSSGGQSF  180
PAAPPMEHQD TARISHDQMC SGFLSFEPLP LQAAAPSTTE GEASSSNAAY YQLAPESSFY  240
HHPYHLLEFP GLPERCGVDP GFVGASAMDD LAYHDLLPPL HPAPMMMPFF GMEYSRDGIK  300
VETRDNFFDD LPPDVFDSFD QVPPPFSPSA TN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-242512627126MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11219GGRRDGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL6630003e-55AL663000.4 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBb0034G17, complete sequence.
GenBankAL7316133e-55AL731613.5 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0065H10, complete sequence.
GenBankAP0149603e-55AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankCP0126123e-55CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
GenBankCR8552183e-55CR855218.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSIGBa0106P14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010240210.21e-152PREDICTED: myb-related protein MYBAS2
TrEMBLW5APB40.0W5APB4_WHEAT; Uncharacterized protein
STRINGBRADI5G17600.11e-154(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57003357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.12e-62MYB family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]